![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
![]() | Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
![]() | Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
![]() | Protein Ribosomal protein L15 (L15p) [52082] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [159454] (11 PDB entries) Uniprot Q72I23 5-150 |
![]() | Domain d2v47p1: 2v47 P:5-150 [152515] Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1 automatically matched to 2J01 P:5-150 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOP Domain Sequences for d2v47p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v47p1 c.12.1.1 (P:5-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]} dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk vvahafsksaleklkaaggepvllea
Timeline for d2v47p1: