![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
![]() | Protein automated matches [190312] (14 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [255602] (2 PDB entries) |
![]() | Domain d2v3wb1: 2v3w B:182-341 [152468] Other proteins in same PDB: d2v3wa2, d2v3wa3, d2v3wb2, d2v3wb3, d2v3wc2, d2v3wc3, d2v3wd2, d2v3wd3 automated match to d1q6za1 complexed with mg, so4, tpp |
PDB Entry: 2v3w (more details), 2.2 Å
SCOPe Domain Sequences for d2v3wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v3wb1 c.31.1.0 (B:182-341) automated matches {Pseudomonas putida [TaxId: 303]} svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d2v3wb1: