Lineage for d2v3wb1 (2v3w B:182-341)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2863020Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2863021Protein automated matches [190312] (14 species)
    not a true protein
  7. 2863114Species Pseudomonas putida [TaxId:303] [255602] (2 PDB entries)
  8. 2863118Domain d2v3wb1: 2v3w B:182-341 [152468]
    Other proteins in same PDB: d2v3wa2, d2v3wa3, d2v3wb2, d2v3wb3, d2v3wc2, d2v3wc3, d2v3wd2, d2v3wd3
    automated match to d1q6za1
    complexed with mg, so4, tpp

Details for d2v3wb1

PDB Entry: 2v3w (more details), 2.2 Å

PDB Description: crystal structure of the benzoylformate decarboxylase variant l461a from pseudomonas putida
PDB Compounds: (B:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d2v3wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3wb1 c.31.1.0 (B:182-341) automated matches {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOPe Domain Coordinates for d2v3wb1:

Click to download the PDB-style file with coordinates for d2v3wb1.
(The format of our PDB-style files is described here.)

Timeline for d2v3wb1: