SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2v3wb3 (2v3w B:342-527)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108851Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2108852Protein automated matches [227126] (17 species)
    not a true protein
  7. 2109016Species Pseudomonas putida [TaxId:303] [254984] (35 PDB entries)
  8. 2109120Domain d2v3wb3: 2v3w B:342-527 [152470]
    Other proteins in same PDB: d2v3wa1, d2v3wb1, d2v3wc1, d2v3wd1
    automated match to d1q6za3
    complexed with mg, so4, tpp

Details for d2v3wb3

PDB Entry: 2v3w (more details), 2.2 Å

PDB Description: Crystal structure of the benzoylformate decarboxylase variant L461A from Pseudomonas putida
PDB Compounds: (B:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d2v3wb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3wb3 c.36.1.0 (B:342-527) automated matches {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygaa
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvspv

SCOPe Domain Coordinates for d2v3wb3:

Click to download the PDB-style file with coordinates for d2v3wb3.
(The format of our PDB-style files is described here.)

Timeline for d2v3wb3: