Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.3: Small subunit [58132] (3 proteins) |
Protein Prokaryotic (30S subunit) [58133] (1 species) |
Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries) |
Domain d2uxde1: 2uxd E:5-154 [152285] Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1 automatically matched to d1fkae_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxd (more details), 3.2 Å
SCOPe Domain Sequences for d2uxde1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxde1 i.1.1.3 (E:5-154) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg srnpiniayatmealrqlrtkadverlrkg
Timeline for d2uxde1: