Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein S11 [53141] (2 species) |
Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries) Uniprot P80376 |
Domain d2uxdk1: 2uxd K:11-126 [152291] Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1 automatically matched to d1i94k_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxd (more details), 3.2 Å
SCOPe Domain Sequences for d2uxdk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxdk1 c.55.4.1 (K:11-126) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr
Timeline for d2uxdk1: