Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) |
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
Protein Ribosomal protein S6 [54997] (4 species) |
Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries) Uniprot P23370 |
Domain d2uxdf1: 2uxd F:1-101 [152286] Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1 automatically matched to d1fjgf_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxd (more details), 3.2 Å
SCOPe Domain Sequences for d2uxdf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxdf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d2uxdf1: