SCOPe 2.07: Domain d2ux0a1: 2ux0 A:387-521

Lineage for d2ux0a1 (2ux0 A:387-521)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
   automatically mapped to Pfam PF13474
   automatically mapped to Pfam PF08332

6. Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159962] (1 PDB entry)
   Uniprot Q8N4I3 387-521

8. Domain d2ux0a1: 2ux0 A:387-521 [152231]
   Other proteins in same PDB: d2ux0b_, d2ux0c_, d2ux0d_, d2ux0e_, d2ux0f_
   complexed with gly

Details for d2ux0a1

PDB Entry: 2ux0, 2.46 Å

PDB Description: structure of the oligomerisation domain of calcium-calmodulin dependent protein kinase ii gamma

PDB Compounds: (A:) calcium-calmodulin dependent protein kinase (cam kinase) II gamma

SCOPe Domain Sequences for d2ux0a1:

Sequence; same for both SEQRES and ATOM records:

>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]}
tededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfhkf
yfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvwhr
rdgkwlnvhyhcsga

Timeline for d2ux0a1:

• d2ux0a1 first appeared in SCOP 1.75
  
• d2ux0a1 appears in SCOPe 2.06
  
• d2ux0a1 appears in the current release, SCOPe 2.08