PDB entry 2ux0

View 2ux0 on RCSB PDB site
Description: structure of the oligomerisation domain of calcium-calmodulin dependent protein kinase II gamma
Class: transferase
Keywords: transferase, calmodulin, protein kinase, oligomerisation domain, serine- threonine kinase, ATP-binding, kinase, nucleotide-binding, serine/threonine-protein kinase, transferase.
Deposited on 2007-03-26, released 2007-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium-calmodulin dependent protein kinase (cam kinase) II gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UX0 (0-1)
    • Uniprot Q8N4I3 (2-End)
    Domains in SCOPe 2.07: d2ux0a1
  • Chain 'B':
    Compound: calcium-calmodulin dependent protein kinase (cam kinase) II gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UX0 (0-1)
    • Uniprot Q8N4I3 (2-End)
    Domains in SCOPe 2.07: d2ux0b_
  • Chain 'C':
    Compound: calcium-calmodulin dependent protein kinase (cam kinase) II gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UX0 (0-1)
    • Uniprot Q8N4I3 (2-End)
    Domains in SCOPe 2.07: d2ux0c_
  • Chain 'D':
    Compound: calcium-calmodulin dependent protein kinase (cam kinase) II gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UX0 (Start-1)
    • Uniprot Q8N4I3 (2-End)
    Domains in SCOPe 2.07: d2ux0d_
  • Chain 'E':
    Compound: calcium-calmodulin dependent protein kinase (cam kinase) II gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UX0 (Start-1)
    • Uniprot Q8N4I3 (2-End)
    Domains in SCOPe 2.07: d2ux0e_
  • Chain 'F':
    Compound: calcium-calmodulin dependent protein kinase (cam kinase) II gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UX0
    • Uniprot Q8N4I3 (2-End)
    Domains in SCOPe 2.07: d2ux0f_
  • Heterogens: GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ux0A (A:)
    smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
    kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
    hrrdgkwlnvhyhcsgapaaprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux0A (A:)
    smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
    kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
    hrrdgkwlnvhyhcsga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ux0B (B:)
    smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
    kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
    hrrdgkwlnvhyhcsgapaaprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux0B (B:)
    smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
    kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
    hrrdgkwlnvhyhcsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ux0C (C:)
    smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
    kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
    hrrdgkwlnvhyhcsgapaaprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux0C (C:)
    smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
    kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
    hrrdgkwlnvhyhcsga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ux0D (D:)
    smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
    kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
    hrrdgkwlnvhyhcsgapaaprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux0D (D:)
    mtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfhk
    fyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvwh
    rrdgkwlnvhyhcsga
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ux0E (E:)
    smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
    kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
    hrrdgkwlnvhyhcsgapaaprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux0E (E:)
    mtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfhk
    fyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvwh
    rrdgkwlnvhyhcsg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ux0F (F:)
    smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
    kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
    hrrdgkwlnvhyhcsgapaaprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux0F (F:)
    tededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfhkf
    yfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvwhr
    rdgkwlnvhyhcsg