SCOPe 2.08: Domain d2uuia1: 2uui A:2-147

Lineage for d2uuia1 (2uui A:2-147)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.56: MAPEG domain-like [161083] (1 superfamily)
   4 helices, bundle; left-handed superhelix

4. Superfamily f.56.1: MAPEG domain-like [161084] (2 families)

5. Family f.56.1.1: MAPEG domain [161085] (3 proteins)
   Pfam PF01124

6. Protein Leukotriene C4 synthase [161090] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161091] (4 PDB entries)
   Uniprot Q16873 2-147

8. Domain d2uuia1: 2uui A:2-147 [152184]
   Other proteins in same PDB: d2uuia2
   automatically matched to 2PNO A:2-147
   complexed with lmt, ni, plm, so4

Details for d2uuia1

PDB Entry: 2uui, 2 Å

PDB Description: crystal structure of human leukotriene c4 synthase

PDB Compounds: (A:) leukotriene c4 synthase

SCOPe Domain Sequences for d2uuia1:

Sequence; same for both SEQRES and ATOM records:

>d2uuia1 f.56.1.1 (A:2-147) Leukotriene C4 synthase {Human (Homo sapiens) [TaxId: 9606]}
kdevallaavtllgvllqayfslqvisarrafrvspplttgppefervyraqvncseyfp
lflatlwvagiffhegaaalcglvylfarlryfqgyarsaqlrlaplyasaralwllval
aalgllahflpaalraallgrlrtll

Timeline for d2uuia1:

• d2uuia1 first appeared in SCOP 1.75
  
• d2uuia1 appears in SCOPe 2.07