PDB entry 2uui

View 2uui on RCSB PDB site
Description: crystal structure of human leukotriene c4 synthase
Class: lyase
Keywords: leukotriene signalling, leukotriene biosynthesis, membrane, eicosanoid, transmembrane, membrane protein, apo, lyase, mapeg, human, ltc4s, enzyme, trimer
Deposited on 2007-03-02, released 2007-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: leukotriene c4 synthase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2UUI (0-6)
  • Uniprot Q16873 (7-155)
  Domains in SCOPe 2.08: d2uuia1, d2uuia2
• Heterogens: NI, LMT, PLM, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uuiA (A:)
  mhhhhhhkdevallaavtllgvllqayfslqvisarrafrvspplttgppefervyraqv
  ncseyfplflatlwvagiffhegaaalcglvylfarlryfqgyarsaqlrlaplyasara
  lwllvalaalgllahflpaalraallgrlrtllpwa