Class j: Peptides [58231] (151 folds) |
Fold j.16: Corticotropin releasing hormone [58384] (1 superfamily) |
Superfamily j.16.1: Corticotropin releasing hormone [58385] (1 family) |
Family j.16.1.1: Corticotropin releasing hormone [58386] (1 protein) |
Protein Corticotropin releasing hormone [58387] (3 species) |
Species Synthetic construct [TaxId:32630] [161297] (2 PDB entries) |
Domain d2rmea1: 2rme A:1-38 [152163] automatically matched to d1go9a_ |
PDB Entry: 2rme (more details)
SCOPe Domain Sequences for d2rmea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rmea1 j.16.1.1 (A:1-38) Corticotropin releasing hormone {Synthetic construct [TaxId: 32630]} ppisldltfhllrevlelaraeqlaqqehskrklleii
Timeline for d2rmea1: