Lineage for d2rmea1 (2rme A:1-38)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046211Fold j.16: Corticotropin releasing hormone [58384] (1 superfamily)
  4. 3046212Superfamily j.16.1: Corticotropin releasing hormone [58385] (1 family) (S)
  5. 3046213Family j.16.1.1: Corticotropin releasing hormone [58386] (1 protein)
  6. 3046214Protein Corticotropin releasing hormone [58387] (3 species)
  7. 3046221Species Synthetic construct [TaxId:32630] [161297] (2 PDB entries)
  8. 3046222Domain d2rmea1: 2rme A:1-38 [152163]
    automatically matched to d1go9a_

Details for d2rmea1

PDB Entry: 2rme (more details)

PDB Description: stressin
PDB Compounds: (A:) Stressin

SCOPe Domain Sequences for d2rmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmea1 j.16.1.1 (A:1-38) Corticotropin releasing hormone {Synthetic construct [TaxId: 32630]}
ppisldltfhllrevlelaraeqlaqqehskrklleii

SCOPe Domain Coordinates for d2rmea1:

Click to download the PDB-style file with coordinates for d2rmea1.
(The format of our PDB-style files is described here.)

Timeline for d2rmea1: