![]() | Class j: Peptides [58231] (121 folds) |
![]() | Fold j.16: Corticotropin releasing hormone [58384] (1 superfamily) |
![]() | Superfamily j.16.1: Corticotropin releasing hormone [58385] (1 family) ![]() |
![]() | Family j.16.1.1: Corticotropin releasing hormone [58386] (1 protein) |
![]() | Protein Corticotropin releasing hormone [58387] (3 species) |
![]() | Species synthetic construct [TaxId:32630] [161297] (2 PDB entries) |
![]() | Domain d2rmea1: 2rme A:1-38 [152163] automatically matched to d1go9a_ |
PDB Entry: 2rme (more details)
SCOP Domain Sequences for d2rmea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rmea1 j.16.1.1 (A:1-38) Corticotropin releasing hormone {synthetic construct} ppisldltfhllrevlelaraeqlaqqehskrklleii
Timeline for d2rmea1: