| Class g: Small proteins [56992] (94 folds) |
| Fold g.27: FnI-like domain [57602] (1 superfamily) disulfide-rich, all-beta |
Superfamily g.27.1: FnI-like domain [57603] (3 families) ![]() |
| Family g.27.1.1: Fibronectin type I module [57604] (2 proteins) automatically mapped to Pfam PF00039 |
| Protein Fibronectin [57605] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries) |
| Domain d2rl0d1: 2rl0 D:153-197 [152132] automatically matched to d1fbra1 |
PDB Entry: 2rl0 (more details), 2 Å
SCOPe Domain Sequences for d2rl0d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rl0d1 g.27.1.1 (D:153-197) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr
Timeline for d2rl0d1: