SCOP 1.75: Domain d2rl0d1: 2rl0 D:153-197

Lineage for d2rl0d1 (2rl0 D:153-197)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (2 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries)

8. Domain d2rl0d1: 2rl0 D:153-197 [152132]
   automatically matched to d1fbra1

Details for d2rl0d1

PDB Entry: 2rl0, 2 Å

PDB Description: Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5

PDB Compounds: (D:) Fibronectin

SCOP Domain Sequences for d2rl0d1:

Sequence; same for both SEQRES and ATOM records:

>d2rl0d1 g.27.1.1 (D:153-197) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr

Timeline for d2rl0d1:

• d2rl0d1 is new in SCOP 1.75
  
• d2rl0d1 appears in SCOPe 2.01
  
• d2rl0d1 appears in the current release, SCOPe 2.08