Class g: Small proteins [56992] (98 folds) |
Fold g.27: FnI-like domain [57602] (1 superfamily) disulfide-rich, all-beta |
Superfamily g.27.1: FnI-like domain [57603] (3 families) |
Family g.27.1.1: Fibronectin type I module [57604] (2 proteins) automatically mapped to Pfam PF00039 |
Protein Fibronectin [57605] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries) |
Domain d2rkze2: 2rkz E:109-150 [152125] automatically matched to d2cg6a1 complexed with ace, nh2, sin |
PDB Entry: 2rkz (more details), 2 Å
SCOPe Domain Sequences for d2rkze2:
Sequence, based on SEQRES records: (download)
>d2rkze2 g.27.1.1 (E:109-150) Fibronectin {Human (Homo sapiens) [TaxId: 9606]} rcheggqsykigdtwrrphetggymlecvclgngkgewtckp
>d2rkze2 g.27.1.1 (E:109-150) Fibronectin {Human (Homo sapiens) [TaxId: 9606]} rcheggqsykigdtwrrplecvclgngkgewtckp
Timeline for d2rkze2: