Lineage for d2rkzb1 (2rkz B:63-108)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639572Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 2639573Superfamily g.27.1: FnI-like domain [57603] (3 families) (S)
  5. 2639574Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
    automatically mapped to Pfam PF00039
  6. 2639575Protein Fibronectin [57605] (1 species)
  7. 2639576Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)
  8. 2639587Domain d2rkzb1: 2rkz B:63-108 [152118]
    automatically matched to d1o9aa2
    complexed with ace, nh2, sin

Details for d2rkzb1

PDB Entry: 2rkz (more details), 2 Å

PDB Description: crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1
PDB Compounds: (B:) Fibronectin

SCOPe Domain Sequences for d2rkzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rkzb1 g.27.1.1 (B:63-108) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
eetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctian

SCOPe Domain Coordinates for d2rkzb1:

Click to download the PDB-style file with coordinates for d2rkzb1.
(The format of our PDB-style files is described here.)

Timeline for d2rkzb1: