Lineage for d2reth_ (2ret H:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199703Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1199704Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 1199771Family d.24.1.5: EpsJ-like [160127] (2 proteins)
  6. 1199775Protein Type II secretory pathway component EpsJ [160128] (1 species)
  7. 1199776Species Vibrio vulnificus [TaxId:672] [160129] (2 PDB entries)
    Uniprot Q7MPZ0 48-213
  8. 1199780Domain d2reth_: 2ret H: [151990]
    Other proteins in same PDB: d2reta1, d2retc_, d2rete_, d2retg_
    automated match to d2retb1
    complexed with cl, na

Details for d2reth_

PDB Entry: 2ret (more details), 2.21 Å

PDB Description: the crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus
PDB Compounds: (H:) EpsJ

SCOPe Domain Sequences for d2reth_:

Sequence, based on SEQRES records: (download)

>d2reth_ d.24.1.5 (H:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimf
arlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvr
fydgkqwinewsneltlpaaisveltlkdygkiartyltpegnlq

Sequence, based on observed residues (ATOM records): (download)

>d2reth_ d.24.1.5 (H:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtkkllhwadylldsdnkgimfarlgwh
npqqqfprgevtkvgyrikderlervwwrypdtpqegvvtpllsdveelnvrfydgkqwi
newsneltlpaaisveltlkdygkiartyltpegnlq

SCOPe Domain Coordinates for d2reth_:

Click to download the PDB-style file with coordinates for d2reth_.
(The format of our PDB-style files is described here.)

Timeline for d2reth_: