Lineage for d2retc_ (2ret C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199703Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1199704Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 1199789Family d.24.1.7: GSPII I/J protein-like [160135] (2 proteins)
    Pfam PF02501
  6. 1199790Protein Pseudopilin EpsI [160136] (1 species)
  7. 1199791Species Vibrio vulnificus [TaxId:672] [160137] (2 PDB entries)
    Uniprot Q7MPZ1 63-143
  8. 1199793Domain d2retc_: 2ret C: [151985]
    Other proteins in same PDB: d2retb1, d2retd_, d2retf_, d2reth_
    automated match to d2reta1
    complexed with cl, na

Details for d2retc_

PDB Entry: 2ret (more details), 2.21 Å

PDB Description: the crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus
PDB Compounds: (C:) Pseudopilin EpsI

SCOPe Domain Sequences for d2retc_:

Sequence, based on SEQRES records: (download)

>d2retc_ d.24.1.7 (C:) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]}
tvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllkaf
dvsvaattqaspiitvrsyvas

Sequence, based on observed residues (ATOM records): (download)

>d2retc_ d.24.1.7 (C:) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]}
tvgyleqkmfaamvadnqmamvmlnpklkasngeeelagqtwywkvapvatqpllkafdv
svaattqaspiitvrsyvas

SCOPe Domain Coordinates for d2retc_:

Click to download the PDB-style file with coordinates for d2retc_.
(The format of our PDB-style files is described here.)

Timeline for d2retc_: