Lineage for d2rdjb2 (2rdj B:1-240)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055706Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1055707Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1056547Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 1056548Protein DinB homolog (DBH) [100889] (3 species)
  7. 1056558Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (50 PDB entries)
  8. 1056581Domain d2rdjb2: 2rdj B:1-240 [151933]
    Other proteins in same PDB: d2rdja1, d2rdjb1
    automatically matched to d1jx4a2
    protein/DNA complex; complexed with ca, gol, tmp

Details for d2rdjb2

PDB Entry: 2rdj (more details), 2.2 Å

PDB Description: snapshots of a y-family dna polymerase in replication: dpo4 in apo and binary/ternary complex forms
PDB Compounds: (B:) DNA polymerase IV

SCOPe Domain Sequences for d2rdjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdjb2 e.8.1.7 (B:1-240) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOPe Domain Coordinates for d2rdjb2:

Click to download the PDB-style file with coordinates for d2rdjb2.
(The format of our PDB-style files is described here.)

Timeline for d2rdjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rdjb1