SCOP 1.75: Domain d2rdjb2: 2rdj B:1-240

Lineage for d2rdjb2 (2rdj B:1-240)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein DinB homolog (DBH) [100889] (3 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (50 PDB entries)

8. Domain d2rdjb2: 2rdj B:1-240 [151933]
   Other proteins in same PDB: d2rdja1, d2rdjb1
   automatically matched to d1jx4a2
   complexed with ca, gol, tmp

Details for d2rdjb2

PDB Entry: 2rdj, 2.2 Å

PDB Description: snapshots of a y-family dna polymerase in replication: dpo4 in apo and binary/ternary complex forms

PDB Compounds: (B:) DNA polymerase IV

SCOP Domain Sequences for d2rdjb2:

Sequence; same for both SEQRES and ATOM records:

>d2rdjb2 e.8.1.7 (B:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d2rdjb2:

• d2rdjb2 is new in SCOP 1.75
  
• d2rdjb2 appears in SCOPe 2.01
  
• d2rdjb2 appears in the current release, SCOPe 2.08