![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries) |
![]() | Domain d2rcjj1: 2rcj J:11-116 [151900] Other proteins in same PDB: d2rcja2, d2rcjb2, d2rcje2, d2rcjf2, d2rcji2, d2rcjj2, d2rcjm2, d2rcjn2, d2rcjq2, d2rcjr2, d2rcju1 automatically matched to d1ymme1 |
PDB Entry: 2rcj (more details)
SCOPe Domain Sequences for d2rcjj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcjj1 b.1.1.1 (J:11-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} vvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhyadsvkgrfti srndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtv
Timeline for d2rcjj1: