![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
![]() | Domain d2rcjr2: 2rcj R:120-218 [151909] Other proteins in same PDB: d2rcja1, d2rcjb1, d2rcje1, d2rcjf1, d2rcji1, d2rcjj1, d2rcjm1, d2rcjn1, d2rcjq1, d2rcjr1 automatically matched to d2ig2h2 |
PDB Entry: 2rcj (more details)
SCOPe Domain Sequences for d2rcjr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcjr2 b.1.1.2 (R:120-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
Timeline for d2rcjr2: