![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins) Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals |
![]() | Protein Uncharacterized protein YgdI [159055] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [159056] (1 PDB entry) Uniprot Q7CPV8 23-75 |
![]() | Domain d2ra2e_: 2ra2 E: [151815] Other proteins in same PDB: d2ra2a2, d2ra2b3, d2ra2b4, d2ra2c3 automated match to d2ra2a1 |
PDB Entry: 2ra2 (more details), 1.9 Å
SCOPe Domain Sequences for d2ra2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ra2e_ b.38.1.6 (E:) Uncharacterized protein YgdI {Salmonella typhimurium [TaxId: 90371]} pnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalen
Timeline for d2ra2e_: