PDB entry 2ra2

View 2ra2 on RCSB PDB site
Description: X-Ray structure of the Q7CPV8 protein from Salmonella typhimurium at the resolution 1.9 A. Northeast Structural Genomics Consortium target StR88A
Class: lipoprotein
Keywords: X-Ray, NESG, StR88A, Q7CPV8, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Lipoprotein, UNKNOWN FUNCTION
Deposited on 2007-09-14, released 2007-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative lipoprotein
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: ygdI, STM2983
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CPV8 (Start-55)
      • expression tag (56-57)
    Domains in SCOPe 2.06: d2ra2a1, d2ra2a2
  • Chain 'B':
    Compound: Putative lipoprotein
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: ygdI, STM2983
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CPV8 (1-55)
      • expression tag (0)
      • expression tag (56-58)
    Domains in SCOPe 2.06: d2ra2b2, d2ra2b3, d2ra2b4
  • Chain 'C':
    Compound: Putative lipoprotein
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: ygdI, STM2983
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CPV8 (Start-55)
      • expression tag (56)
    Domains in SCOPe 2.06: d2ra2c2, d2ra2c3
  • Chain 'D':
    Compound: Putative lipoprotein
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: ygdI, STM2983
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ra2d_
  • Chain 'E':
    Compound: Putative lipoprotein
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: ygdI, STM2983
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ra2e_
  • Chain 'F':
    Compound: Putative lipoprotein
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: ygdI, STM2983
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ra2f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ra2A (A:)
    msgpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ra2A (A:)
    pnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ra2B (B:)
    msgpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ra2B (B:)
    msgpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ra2C (C:)
    msgpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ra2C (C:)
    gpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ra2D (D:)
    msgpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ra2D (D:)
    sgpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalen
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ra2E (E:)
    msgpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ra2E (E:)
    pnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalen
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ra2F (F:)
    msgpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ra2F (F:)
    gpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvale