SCOPe 2.08: Domain d2r9hf1: 2r9h F:1-106

Lineage for d2r9hf1 (2r9h F:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2r9hf1: 2r9h F:1-106 [151786]
   Other proteins in same PDB: d2r9ha_, d2r9hb_, d2r9hc_, d2r9hd2, d2r9he_, d2r9hf2
   automated match to d2dtgb1
   complexed with cl; mutant

Details for d2r9hf1

PDB Entry: 2r9h, 3.1 Å

PDB Description: crystal structure of q207c mutant of clc-ec1 in complex with fab

PDB Compounds: (F:) fab fragment

SCOPe Domain Sequences for d2r9hf1:

Sequence; same for both SEQRES and ATOM records:

>d2r9hf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d2r9hf1:

• d2r9hf1 first appeared in SCOP 1.75
  
• d2r9hf1 appears in SCOPe 2.07