Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d2r9hf2: 2r9h F:107-211 [151787] Other proteins in same PDB: d2r9ha_, d2r9hb_, d2r9hc_, d2r9hd1, d2r9he_, d2r9hf1 automated match to d2dtgb2 complexed with cl; mutant |
PDB Entry: 2r9h (more details), 3.1 Å
SCOPe Domain Sequences for d2r9hf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r9hf2 b.1.1.2 (F:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnra
Timeline for d2r9hf2: