SCOPe 2.08: Domain d2r9hd2: 2r9h D:107-211

Lineage for d2r9hd2 (2r9h D:107-211)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d2r9hd2: 2r9h D:107-211 [151785]
Other proteins in same PDB: d2r9ha_, d2r9hb_, d2r9hc_, d2r9hd1, d2r9he_, d2r9hf1
automated match to d2dtgb2
complexed with cl; mutant

Details for d2r9hd2

PDB Entry: 2r9h (more details), 3.1 Å

PDB Description: crystal structure of q207c mutant of clc-ec1 in complex with fab

PDB Compounds: (D:) fab fragment

SCOPe Domain Sequences for d2r9hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9hd2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d2r9hd2:

Click to download the PDB-style file with coordinates for d2r9hd2.
(The format of our PDB-style files is described here.)

Timeline for d2r9hd2: