Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
Protein Hemolysin TlyC [160839] (1 species) |
Species Xylella fastidiosa [TaxId:2371] [160840] (2 PDB entries) Uniprot Q87DZ3 353-439! Uniprot Q87DZ3 355-439 |
Domain d2r8da1: 2r8d A:7-91 [151714] complexed with mg, mn |
PDB Entry: 2r8d (more details), 2 Å
SCOPe Domain Sequences for d2r8da1:
Sequence, based on SEQRES records: (download)
>d2r8da1 d.145.1.4 (A:7-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]} almvtredgsflidgtlpieelrevlgaelpdgeennyhtlagmcisyfgriphvgeyfd wagwrieivdldgaridklllqrln
>d2r8da1 d.145.1.4 (A:7-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]} almvtredgsflidgtlpieelrevlgaennyhtlagmcisyfgriphvgeyfdwagwri eivdldgaridklllqrln
Timeline for d2r8da1: