Lineage for d2r8da1 (2r8d A:7-91)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2593699Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2593700Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2593884Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 2593885Protein Hemolysin TlyC [160839] (1 species)
  7. 2593886Species Xylella fastidiosa [TaxId:2371] [160840] (2 PDB entries)
    Uniprot Q87DZ3 353-439! Uniprot Q87DZ3 355-439
  8. 2593888Domain d2r8da1: 2r8d A:7-91 [151714]
    complexed with mg, mn

Details for d2r8da1

PDB Entry: 2r8d (more details), 2 Å

PDB Description: the structure of transporter associated domain corc_hlyc from a xylella fastidiosa temecula1 hemolysin in complex with mg++ and mn++
PDB Compounds: (A:) Hemolysin

SCOPe Domain Sequences for d2r8da1:

Sequence, based on SEQRES records: (download)

>d2r8da1 d.145.1.4 (A:7-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]}
almvtredgsflidgtlpieelrevlgaelpdgeennyhtlagmcisyfgriphvgeyfd
wagwrieivdldgaridklllqrln

Sequence, based on observed residues (ATOM records): (download)

>d2r8da1 d.145.1.4 (A:7-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]}
almvtredgsflidgtlpieelrevlgaennyhtlagmcisyfgriphvgeyfdwagwri
eivdldgaridklllqrln

SCOPe Domain Coordinates for d2r8da1:

Click to download the PDB-style file with coordinates for d2r8da1.
(The format of our PDB-style files is described here.)

Timeline for d2r8da1: