PDB entry 2r8d

View 2r8d on RCSB PDB site
Description: The structure of transporter associated domain CorC_HlyC from a Xylella fastidiosa Temecula1 hemolysin in complex with Mg++ and Mn++
Class: toxin
Keywords: CorC, hemolysin, structural genomics, pfam03471, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TOXIN
Deposited on 2007-09-10, released 2007-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemolysin
    Species: Xylella fastidiosa [TaxId:183190]
    Gene: tlyC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2r8da1
  • Heterogens: MN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2r8dA (A:)
snaentdedalmvtredgsflidgtlpieelrevlgaelpdgeennyhtlagmcisyfgr
iphvgeyfdwagwrieivdldgaridklllqrln

    Sequence, based on observed residues (ATOM records): (download) 
    >2r8dA (A:)
almvtredgsflidgtlpieelrevlgaennyhtlagmcisyfgriphvgeyfdwagwri
eivdldgaridklllqrln