SCOPe 2.07: Domain d1m6cb_: 1m6c B:

Lineage for d1m6cb_ (1m6c B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1m6cb_: 1m6c B: [15166]
   complexed with cmo, hem

Details for d1m6cb_

PDB Entry: 1m6c, 1.9 Å

PDB Description: v68n myoglobin with co

PDB Compounds: (B:) protein (myoglobin)

SCOPe Domain Sequences for d1m6cb_:

Sequence; same for both SEQRES and ATOM records:

>d1m6cb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

Timeline for d1m6cb_:

• d1m6cb_ first appeared (with stable ids) in SCOP 1.55
  
• d1m6cb_ appears in SCOPe 2.06
  
• d1m6cb_ appears in the current release, SCOPe 2.08