Lineage for d1m6ca_ (1m6c A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301307Protein Myoglobin [46469] (10 species)
  7. 2301435Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 2301444Domain d1m6ca_: 1m6c A: [15165]
    complexed with cmo, hem

Details for d1m6ca_

PDB Entry: 1m6c (more details), 1.9 Å

PDB Description: v68n myoglobin with co
PDB Compounds: (A:) protein (myoglobin)

SCOPe Domain Sequences for d1m6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ca_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOPe Domain Coordinates for d1m6ca_:

Click to download the PDB-style file with coordinates for d1m6ca_.
(The format of our PDB-style files is described here.)

Timeline for d1m6ca_: