SCOPe 2.02: Domain d2r7ya_: 2r7y A:

Lineage for d2r7ya_ (2r7y A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein BH0863-like Ribonuclease H [142490] (3 species)
   new class of RNase H

7. Species Bacillus halodurans [TaxId:86665] [142491] (16 PDB entries)
   Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
   BH0863

8. Domain d2r7ya_: 2r7y A: [151657]
   automated match to d1zbfa1
   protein/DNA complex; protein/RNA complex; complexed with mg, po4; mutant

Details for d2r7ya_

PDB Entry: 2r7y, 1.8 Å

PDB Description: selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain mutant d132n

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2r7ya_:

Sequence; same for both SEQRES and ATOM records:

>d2r7ya_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikady

Timeline for d2r7ya_:

• d2r7ya_ first appeared in SCOP 1.75, called d2r7ya1
  
• d2r7ya_ appears in SCOPe 2.01
  
• d2r7ya_ appears in SCOPe 2.03
  
• d2r7ya_ appears in the current release, SCOPe 2.08