SCOP 1.75: Domain d2r7ya1: 2r7y A:62-193

Lineage for d2r7ya1 (2r7y A:62-193)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein BH0863-like Ribonuclease H [142490] (1 species)
   new class of RNase H

7. Species Bacillus halodurans [TaxId:86665] [142491] (12 PDB entries)
   Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
   BH0863

8. Domain d2r7ya1: 2r7y A:62-193 [151657]
   automatically matched to d1zbfa1
   complexed with mg, po4, sdg; mutant

Details for d2r7ya1

PDB Entry: 2r7y, 1.8 Å

PDB Description: selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain mutant d132n

PDB Compounds: (A:) Ribonuclease H

SCOP Domain Sequences for d2r7ya1:

Sequence; same for both SEQRES and ATOM records:

>d2r7ya1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikady

Timeline for d2r7ya1:

• d2r7ya1 is new in SCOP 1.75
  
• d2r7ya1 is called d2r7ya_ in SCOPe 2.01
  
• d2r7ya1 appears in the current release, SCOPe 2.08, called d2r7ya_