Lineage for d2r7ca2 (2r7c A:2-143)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685983Fold d.216: Rotavirus NSP2 fragment, N-terminal domain [75573] (1 superfamily)
    consists of six alpha-helices and two beta-hairpins
  4. 1685984Superfamily d.216.1: Rotavirus NSP2 fragment, N-terminal domain [75574] (2 families) (S)
  5. 1685985Family d.216.1.1: Rotavirus NSP2 fragment, N-terminal domain [75575] (1 protein)
  6. 1685986Protein Rotavirus NSP2 fragment, N-terminal domain [75576] (1 species)
  7. 1685987Species Simian 11 rotavirus [TaxId:10923] [75577] (5 PDB entries)
  8. 1685989Domain d2r7ca2: 2r7c A:2-143 [151628]
    Other proteins in same PDB: d2r7ca1
    automated match to d1l9va2
    complexed with po4

Details for d2r7ca2

PDB Entry: 2r7c (more details), 2.7 Å

PDB Description: Crystallographic and biochemical analysis of rotavirus NSP2 with nucleotides reveals an NDP kinase like activity
PDB Compounds: (A:) Non-structural RNA-binding protein 35

SCOPe Domain Sequences for d2r7ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7ca2 d.216.1.1 (A:2-143) Rotavirus NSP2 fragment, N-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
aelacfcyphlendsykfipfnnlaikamltakvdkkdmdkfydsiiygiapppqfkkry
ntndnsrgmnfetimftkvamlicealnslkvtqanvsnvlsrvvsirhlenlvirkenp
qdilfhskdlllkstliaigqs

SCOPe Domain Coordinates for d2r7ca2:

Click to download the PDB-style file with coordinates for d2r7ca2.
(The format of our PDB-style files is described here.)

Timeline for d2r7ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7ca1