SCOP 1.75: Domain d2r7ca2: 2r7c A:2-143

Lineage for d2r7ca2 (2r7c A:2-143)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.216: Rotavirus NSP2 fragment, N-terminal domain [75573] (1 superfamily)
   consists of six alpha-helices and two beta-hairpins

4. Superfamily d.216.1: Rotavirus NSP2 fragment, N-terminal domain [75574] (1 family)

5. Family d.216.1.1: Rotavirus NSP2 fragment, N-terminal domain [75575] (1 protein)

6. Protein Rotavirus NSP2 fragment, N-terminal domain [75576] (1 species)

7. Species Simian 11 rotavirus [TaxId:10923] [75577] (5 PDB entries)

8. Domain d2r7ca2: 2r7c A:2-143 [151628]
   Other proteins in same PDB: d2r7ca1
   automatically matched to d1l9va2
   complexed with po4, psh

Details for d2r7ca2

PDB Entry: 2r7c, 2.7 Å

PDB Description: Crystallographic and biochemical analysis of rotavirus NSP2 with nucleotides reveals an NDP kinase like activity

PDB Compounds: (A:) Non-structural RNA-binding protein 35

SCOP Domain Sequences for d2r7ca2:

Sequence; same for both SEQRES and ATOM records:

>d2r7ca2 d.216.1.1 (A:2-143) Rotavirus NSP2 fragment, N-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
aelacfcyphlendsykfipfnnlaikamltakvdkkdmdkfydsiiygiapppqfkkry
ntndnsrgmnfetimftkvamlicealnslkvtqanvsnvlsrvvsirhlenlvirkenp
qdilfhskdlllkstliaigqs

Timeline for d2r7ca2:

• d2r7ca2 is new in SCOP 1.75
  
• d2r7ca2 appears in SCOPe 2.01
  
• d2r7ca2 appears in the current release, SCOPe 2.08