Lineage for d2r6gb2 (2r6g B:2-235)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478252Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2478395Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 2478396Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)
  8. 2478432Domain d2r6gb2: 2r6g B:2-235 [151607]
    Other proteins in same PDB: d2r6ga1, d2r6ga3, d2r6gb1, d2r6gb3, d2r6ge_, d2r6gf1, d2r6gf2, d2r6gg1
    automated match to d3rlfa1
    complexed with atp, mal

Details for d2r6gb2

PDB Entry: 2r6g (more details), 2.8 Å

PDB Description: the crystal structure of the e. coli maltose transporter
PDB Compounds: (B:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2r6gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6gb2 c.37.1.12 (B:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldqplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

SCOPe Domain Coordinates for d2r6gb2:

Click to download the PDB-style file with coordinates for d2r6gb2.
(The format of our PDB-style files is described here.)

Timeline for d2r6gb2: