Lineage for d2r6gb1 (2r6g B:236-371)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400579Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2400663Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2400683Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2400684Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2400720Domain d2r6gb1: 2r6g B:236-371 [151606]
    Other proteins in same PDB: d2r6ga2, d2r6ga3, d2r6gb2, d2r6gb3, d2r6ge_, d2r6gf1, d2r6gf2, d2r6gg1
    automated match to d3puza2
    complexed with atp, mal

Details for d2r6gb1

PDB Entry: 2r6g (more details), 2.8 Å

PDB Description: the crystal structure of the e. coli maltose transporter
PDB Compounds: (B:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2r6gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6gb1 b.40.6.3 (B:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

SCOPe Domain Coordinates for d2r6gb1:

Click to download the PDB-style file with coordinates for d2r6gb1.
(The format of our PDB-style files is described here.)

Timeline for d2r6gb1: