| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) ![]() |
| Family c.44.2.2: PTS system, Fructose specific IIB subunit-like [159584] (2 proteins) Pfam PF02379 |
| Protein Mannose-specific enzyme IIBCA component ManP, N-terminal domain [159587] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [159588] (1 PDB entry) Uniprot O31645 2-104 |
| Domain d2r48a1: 2r48 A:2-104 [151575] Other proteins in same PDB: d2r48a2 |
PDB Entry: 2r48 (more details), 1.8 Å
SCOPe Domain Sequences for d2r48a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r48a1 c.44.2.2 (A:2-104) Mannose-specific enzyme IIBCA component ManP, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
kllaitscpngiahtymaaenlqkaadrlgvsikvetqggigvenklteeeireadaiii
aadrsvnkdrfigkkllsvgvqdgirkpeeliqkalngdipvy
Timeline for d2r48a1: