Lineage for d2r48a1 (2r48 A:2-104)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130626Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2130767Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 2130782Family c.44.2.2: PTS system, Fructose specific IIB subunit-like [159584] (2 proteins)
    Pfam PF02379
  6. 2130786Protein Mannose-specific enzyme IIBCA component ManP, N-terminal domain [159587] (1 species)
  7. 2130787Species Bacillus subtilis [TaxId:1423] [159588] (1 PDB entry)
    Uniprot O31645 2-104
  8. 2130788Domain d2r48a1: 2r48 A:2-104 [151575]
    Other proteins in same PDB: d2r48a2

Details for d2r48a1

PDB Entry: 2r48 (more details), 1.8 Å

PDB Description: Crystal structure of the fructose specific IIB subunit of PTS system from Bacillus subtilis subsp. subtilis str. 168
PDB Compounds: (A:) Phosphotransferase system (PTS) mannose-specific enzyme IIBCA component

SCOPe Domain Sequences for d2r48a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r48a1 c.44.2.2 (A:2-104) Mannose-specific enzyme IIBCA component ManP, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
kllaitscpngiahtymaaenlqkaadrlgvsikvetqggigvenklteeeireadaiii
aadrsvnkdrfigkkllsvgvqdgirkpeeliqkalngdipvy

SCOPe Domain Coordinates for d2r48a1:

Click to download the PDB-style file with coordinates for d2r48a1.
(The format of our PDB-style files is described here.)

Timeline for d2r48a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r48a2