PDB entry 2r48
View 2r48 on RCSB PDB site
Description: Crystal structure of the fructose specific IIB subunit of PTS system from Bacillus subtilis subsp. subtilis str. 168
Class: transferase, transport protein
Keywords: PTS system, phosphotransferase system, fructose specific IIB subunit, pfam02379, PSI-2, MCSG, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, Membrane, Sugar transport, Transmembrane, Transport, TRANSFERASE, TRANSPORT PROTEIN
Deposited on
2007-08-30, released
2007-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Phosphotransferase system (PTS) mannose-specific enzyme IIBCA component
Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
Gene: manP, BSU12010
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2r48a1, d2r48a2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2r48A (A:)
snakllaitscpngiahtymaaenlqkaadrlgvsikvetqggigvenklteeeireada
iiiaadrsvnkdrfigkkllsvgvqdgirkpeeliqkalngdipvy
Sequence, based on observed residues (ATOM records): (download)
>2r48A (A:)
nakllaitscpngiahtymaaenlqkaadrlgvsikvetqggigvenklteeeireadai
iiaadrsvnkdrfigkkllsvgvqdgirkpeeliqkalngdipvy