SCOPe 2.04: Domain d2r2wu_: 2r2w U:

Lineage for d2r2wu_ (2r2w U:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (68 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d2r2wu_: 2r2w U: [151542]
   automated match to d2vipa1
   complexed with 4pg, so4

Details for d2r2wu_

PDB Entry: 2r2w, 2.01 Å

PDB Description: urokinase plasminogen activator b-chain-gppe complex

PDB Compounds: (U:) Plasminogen activator, urokinase

SCOPe Domain Sequences for d2r2wu_:

Sequence; same for both SEQRES and ATOM records:

>d2r2wu_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke

Timeline for d2r2wu_:

• d2r2wu_ first appeared in SCOP 1.75, called d2r2wu1
  
• d2r2wu_ appears in SCOPe 2.03
  
• d2r2wu_ appears in SCOPe 2.05
  
• d2r2wu_ appears in the current release, SCOPe 2.08