SCOPe 2.01: Domain d2r2sa_: 2r2s A:

Lineage for d2r2sa_ (2r2s A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein MMLV reverse transcriptase [56687] (1 species)

7. Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
   Uniprot P03355 RE 144-594

8. Domain d2r2sa_: 2r2s A: [151538]
   automated match to d1d0ea_
   protein/DNA complex; protein/RNA complex; complexed with 3co, blb

Details for d2r2sa_

PDB Entry: 2r2s, 2.8 Å

PDB Description: co(iii)bleomycinb2 bound to d(attagttataactaat) complexed with mmlv rt catalytic fragment

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d2r2sa_:

Sequence; same for both SEQRES and ATOM records:

>d2r2sa_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

Timeline for d2r2sa_:

• d2r2sa_ first appeared in SCOP 1.75, called d2r2sa1
  
• d2r2sa_ appears in SCOPe 2.02
  
• d2r2sa_ appears in the current release, SCOPe 2.08