PDB entry 2r2s

View 2r2s on RCSB PDB site
Description: Co(III)bleomycinB2 bound to d(ATTAGTTATAACTAAT) complexed with MMLV RT catalytic fragment
Class: transferase/DNA
Keywords: bleomycin, drug-DNA complex, protein-DNA complex, MMLV RT, DNA integration, DNA recombination, Endonuclease, Multifunctional enzyme, Nuclease, Nucleotidyltransferase, RNA-directed DNA polymerase, Transferase, transferase/DNA COMPLEX
Deposited on 2007-08-27, released 2008-07-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Moloney murine leukemia virus [TaxId:11801]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2r2sa_
  • Chain 'B':
    Compound: DNA (5'-d(*dap*dtp*dtp*dap*dgp*dtp*dt)-3')
  • Chain 'G':
    Compound: DNA (5'-d(p*dtp*dap*dap*dcp*dtp*dap*dap*dt)-3')
  • Heterogens: 3CO, BLB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2r2sA (A:)
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    No sequence available.