![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
![]() | Protein Ligand-binding domain of neurexin 1beta [49949] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49950] (5 PDB entries) |
![]() | Domain d2r1dd1: 2r1d D:36-212 [151516] automatically matched to d1c4rg_ complexed with ca |
PDB Entry: 2r1d (more details), 2.6 Å
SCOPe Domain Sequences for d2r1dd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r1dd1 b.29.1.4 (D:36-212) Ligand-binding domain of neurexin 1beta {Norway rat (Rattus norvegicus) [TaxId: 10116]} hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv
Timeline for d2r1dd1: