Lineage for d2r1dh1 (2r1d H:36-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779558Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)
  7. 2779567Species Norway rat (Rattus norvegicus) [TaxId:10116] [49950] (5 PDB entries)
  8. 2779585Domain d2r1dh1: 2r1d H:36-211 [151520]
    automatically matched to d1c4rg_
    complexed with ca

Details for d2r1dh1

PDB Entry: 2r1d (more details), 2.6 Å

PDB Description: crystal structure of rat neurexin 1beta in the ca2+ containing form
PDB Compounds: (H:) Neurexin-1-beta

SCOPe Domain Sequences for d2r1dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1dh1 b.29.1.4 (H:36-211) Ligand-binding domain of neurexin 1beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrl

SCOPe Domain Coordinates for d2r1dh1:

Click to download the PDB-style file with coordinates for d2r1dh1.
(The format of our PDB-style files is described here.)

Timeline for d2r1dh1: