Lineage for d2r0ma1 (2r0m A:239-392)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912955Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 913056Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 913057Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)
  6. 913081Protein Glutaryl-CoA dehydrogenase GCDH [109794] (1 species)
  7. 913082Species Human (Homo sapiens) [TaxId:9606] [109795] (4 PDB entries)
    Uniprot Q92947
  8. 913086Domain d2r0ma1: 2r0m A:239-392 [151504]
    Other proteins in same PDB: d2r0ma2
    automatically matched to d1siqa1
    complexed with 4ni, fad; mutant

Details for d2r0ma1

PDB Entry: 2r0m (more details), 2.7 Å

PDB Description: the effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d2r0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0ma1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]}
lggpfgclnnarygiawgvlgasefclhtarqyaldrmqfgvplarnqliqkkladmlte
itlglhaclqlgrlkdqdkaapemvsllkrnncgkaldiarqardmlggngisdeyhvir
hamnleavntydgthdihalilgraitgiqafta

SCOPe Domain Coordinates for d2r0ma1:

Click to download the PDB-style file with coordinates for d2r0ma1.
(The format of our PDB-style files is described here.)

Timeline for d2r0ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r0ma2