SCOP 1.75: Domain d2r0ma1: 2r0m A:239-392

Lineage for d2r0ma1 (2r0m A:239-392)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)

6. Protein Glutaryl-CoA dehydrogenase GCDH [109794] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109795] (4 PDB entries)
   Uniprot Q92947

8. Domain d2r0ma1: 2r0m A:239-392 [151504]
   Other proteins in same PDB: d2r0ma2
   automatically matched to d1siqa1
   complexed with 4ni, fad; mutant

Details for d2r0ma1

PDB Entry: 2r0m, 2.7 Å

PDB Description: the effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate

PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOP Domain Sequences for d2r0ma1:

Sequence; same for both SEQRES and ATOM records:

>d2r0ma1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]}
lggpfgclnnarygiawgvlgasefclhtarqyaldrmqfgvplarnqliqkkladmlte
itlglhaclqlgrlkdqdkaapemvsllkrnncgkaldiarqardmlggngisdeyhvir
hamnleavntydgthdihalilgraitgiqafta

Timeline for d2r0ma1:

• d2r0ma1 is new in SCOP 1.75
  
• d2r0ma1 appears in SCOPe 2.01
  
• d2r0ma1 appears in the current release, SCOPe 2.08