![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
![]() | Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries) Uniprot Q07343 324-667 |
![]() | Domain d2qyla_: 2qyl A: [151474] automated match to d2qykb_ complexed with mg, npv, zn |
PDB Entry: 2qyl (more details), 1.95 Å
SCOPe Domain Sequences for d2qyla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qyla_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]} msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi vhplwetwadlvqpdaqdildtlednrnwyqsmip
Timeline for d2qyla_: