SCOPe 2.08: Domain d2qyla_: 2qyl A:

Lineage for d2qyla_ (2qyl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries)
   Uniprot Q07343 324-667

8. Domain d2qyla_: 2qyl A: [151474]
   automated match to d2qykb_
   complexed with mg, npv, zn

Details for d2qyla_

PDB Entry: 2qyl, 1.95 Å

PDB Description: Crystal structure of PDE4B2B in complex with inhibitor NPV

PDB Compounds: (A:) Phosphodiesterase 4B, cAMP-specific

SCOPe Domain Sequences for d2qyla_:

Sequence; same for both SEQRES and ATOM records:

>d2qyla_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
vhplwetwadlvqpdaqdildtlednrnwyqsmip

Timeline for d2qyla_:

• d2qyla_ first appeared in SCOP 1.75, called d2qyla1
  
• d2qyla_ appears in SCOPe 2.07