SCOP 1.75: Domain d2qyla1: 2qyl A:153-485

Lineage for d2qyla1 (2qyl A:153-485)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (22 PDB entries)
   Uniprot Q08499 388-713

8. Domain d2qyla1: 2qyl A:153-485 [151474]
   automatically matched to d1oyna_
   complexed with mg, npv, zn

Details for d2qyla1

PDB Entry: 2qyl, 1.95 Å

PDB Description: Crystal structure of PDE4B2B in complex with inhibitor NPV

PDB Compounds: (A:) Phosphodiesterase 4B, cAMP-specific

SCOP Domain Sequences for d2qyla1:

Sequence; same for both SEQRES and ATOM records:

>d2qyla1 a.211.1.2 (A:153-485) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
isrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfris
sdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaa
ihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrq
tlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcad
lsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivh
plwetwadlvqpdaqdildtlednrnwyqsmip

Timeline for d2qyla1:

• d2qyla1 is new in SCOP 1.75
  
• d2qyla1 appears in SCOPe 2.01
  
• d2qyla1 appears in the current release, SCOPe 2.08, called d2qyla_