SCOPe 2.01: Domain d2quja1: 2quj A:97-469

Lineage for d2quja1 (2quj A:97-469)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (4 species)
   overall structure is similar to TyrRS

7. Species Human (Homo sapiens) [TaxId:9606] [102256] (11 PDB entries)
   Uniprot P23381 94-471

8. Domain d2quja1: 2quj A:97-469 [151373]
   automatically matched to d1ulhb_
   protein/RNA complex; complexed with cl, gol, trp, tym

Details for d2quja1

PDB Entry: 2quj, 2.42 Å

PDB Description: Crystal structures of human tryptophanyl-tRNA synthetase in complex with TrpAMP

PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2quja1:

Sequence; same for both SEQRES and ATOM records:

>d2quja1 c.26.1.1 (A:97-469) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyav
enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
stffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdv
dvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdei
vkefmtprklsfd

Timeline for d2quja1:

• d2quja1 first appeared in SCOP 1.75
  
• d2quja1 appears in SCOPe 2.02
  
• d2quja1 appears in the current release, SCOPe 2.08, called d2quja2